Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Mouse (HEK293, His)

MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-mouse-hek293-his.html

Purity

95.80

Smiles

MGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

17390 (Gene_ID) NP_032636.1 (M409-C662) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit
MBS7618510-01 48 Well

Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit
MBS7618510-02 96 Well

Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit
MBS7618510-03 5x 96 Well

Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit
MBS7618510-04 10x 96 Well

Mouse COL4alpha1 (Collagen Type IV Alpha 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human Resolvin D1 (RvD1) ELISA Kit
EK11723 48 Tests

Human Resolvin D1 (RvD1) ELISA Kit

Sign In for Pricing
View Details
Human Huntingtin (HTT) ELISA Kit
DLR-HTT-Hu-01 48 Tests

Human Huntingtin (HTT) ELISA Kit

Sign In for Pricing
View Details