Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-4, Mouse (His)

Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses.IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23.Animal-Free IL-4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-4 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-4-protein-mouse-his.html

Purity

98.0

Smiles

MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD27/TNFRSF7 Protein (Fc & His Tag)
PKSM041253-01 10 µg

Recombinant Mouse CD27/TNFRSF7 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD27/TNFRSF7 Protein (Fc & His Tag)
PKSM041253-02 50 µg

Recombinant Mouse CD27/TNFRSF7 Protein (Fc & His Tag)

Sign In for Pricing
View Details
APBA2 Human Gene Knockout Kit (CRISPR)
KN414824 1 Kit

APBA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CYP11B2 Rabbit Monoclonal Antibody [Clone ID: R07-4J-6]
TA421662 100 µL

CYP11B2 Rabbit Monoclonal Antibody [Clone ID: R07-4J-6]

Sign In for Pricing
View Details
RDH11 (NM_016026) Human Over-expression Lysate
LC402488 20 µg

RDH11 (NM_016026) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse CD70 Protein (His Tag)
PDMM100063-01 20 µg

Recombinant Mouse CD70 Protein (His Tag)

Sign In for Pricing
View Details