Animal-Free IL-4, Mouse (His)
Interleukin 4 (IL-4) Protein is a pleiotropic cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses.IL-4 participates in STAT6 signaling and regulates the expression of MHC II, IgE, IgG1 amd CD23.Animal-Free IL-4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-4 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-4 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-4-protein-mouse-his.html
Purity
98.0
Smiles
MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Molecular Formula
16189 (Gene_ID) P07750 (H21-S140) (Accession)
Molecular Weight
Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
