Animal-Free NAP-2/CXCL7, Human (His)
NAP-2/CXCL7 protein (LA-PF4) triggers DNA synthesis, mitosis, glycolysis, cAMP accumulation, and hyaluronic acid synthesis. It contributes to the formation of plasminogen activator in human synovial cells and acts as a CXCR1/CXCR2 ligand together with variants such as NAP-2 (73) . Animal-Free NAP-2/CXCL7 Protein, Human (His) is the recombinant human-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free NAP-2/CXCL7 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-nap-2-cxcl7-protein-human-his.html
Purity
95.0
Smiles
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Molecular Formula
5473 (Gene_ID) P02775 (A59-D128) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), CF640R conjugate, 0.1mg/mL
(3a,5beta,7a,12a,23S)-Cholestane-3,7,12,23,25-pentol-d6
![PerCP Anti-Rat CD4 (domain 1) Antibody[OX-38]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d42cf/imageurl/e-ab-f1105f.webp)
PerCP Anti-Rat CD4 (domain 1) Antibody[OX-38]
PerCP Anti-Rat CD4 (domain 1) Antibody[OX-38]