Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100B, Mouse (His)

The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities.Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both.S100B Protein, Mouse (His) is the recombinant mouse-derived S100B protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100B Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100b-protein-mouse-his.html

Purity

98.0

Smiles

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Formula

20203 (Gene_ID) P50114 (M1-E92) (Accession)

Molecular Weight

Approximately 11.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-miR-679-3p-Off Virus
mm5936 1.0 mL

AdmiRa-mmu-miR-679-3p-Off Virus

Sign In for Pricing
View Details
Rat Solute Carrier Family 26, Member 4 ELISA Kit
MBS073198-01 48 Well

Rat Solute Carrier Family 26, Member 4 ELISA Kit

Sign In for Pricing
View Details
Rat Solute Carrier Family 26, Member 4 ELISA Kit
MBS073198-02 96 Well

Rat Solute Carrier Family 26, Member 4 ELISA Kit

Sign In for Pricing
View Details
Rat Solute Carrier Family 26, Member 4 ELISA Kit
MBS073198-03 5x 96 Well

Rat Solute Carrier Family 26, Member 4 ELISA Kit

Sign In for Pricing
View Details
Rat Solute Carrier Family 26, Member 4 ELISA Kit
MBS073198-04 10x 96 Well

Rat Solute Carrier Family 26, Member 4 ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protein 146 (TMEM146) ELISA Kit
MBS9917440-01 48 Well

Human Transmembrane Protein 146 (TMEM146) ELISA Kit

Sign In for Pricing
View Details