Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100B, Mouse (His)

The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities.Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both.S100B Protein, Mouse (His) is the recombinant mouse-derived S100B protein, expressed by E.coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100B Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100b-protein-mouse-his.html

Purity

98.0

Smiles

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Formula

20203 (Gene_ID) P50114 (M1-E92) (Accession)

Molecular Weight

Approximately 11.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDHF14 Polyclonal Antibody PE Conjugated
C90995PE 100 µL

CDHF14 Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
Lentiviral human TLN2 shRNA (UAS) - Lentiviral human TLN2 shRNA (UAS, iRFP) plasmid
GTR15086248 1 Vial

Lentiviral human TLN2 shRNA (UAS) - Lentiviral human TLN2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Suberoyl bis-hydroxamic acid
BML-GR323-0100 100 mg

Suberoyl bis-hydroxamic acid

Sign In for Pricing
View Details
ZNF337 Antibody
MBS8510987-01 0.05 mg

ZNF337 Antibody

Sign In for Pricing
View Details
ZNF337 Antibody
MBS8510987-02 0.1 mg

ZNF337 Antibody

Sign In for Pricing
View Details
ZNF337 Antibody
MBS8510987-03 0.1 mL (AF750)

ZNF337 Antibody

Sign In for Pricing
View Details