Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1E1, Human (His)

The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

EEF1E1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eef1e1-protein-human-his.html

Purity

95.20

Smiles

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Molecular Formula

9521 (Gene_ID) O43324 (M1-H174) (Accession)

Molecular Weight

Approximately 22 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP91 Antibody - N-terminal region : HRP (ARP36119_T100-HRP)
ARP36119_T100-HRP 100 µL

ZFP91 Antibody - N-terminal region : HRP (ARP36119_T100-HRP)

Sign In for Pricing
View Details
KCNE1L Rabbit Polyclonal Antibody (BF405)
orb1610886 100 µL

KCNE1L Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
HSPD1P18 ORF Vector (Human) (pORF)
ORF021234 1.0 µg DNA

HSPD1P18 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-ALDH1A2 Rabbit pAb
GB112485-100 100 μL

Anti-ALDH1A2 Rabbit pAb

Sign In for Pricing
View Details
Olfr464 Mouse siRNA Oligo Duplex (Locus ID 258407)
SR409858 1 Kit

Olfr464 Mouse siRNA Oligo Duplex (Locus ID 258407)

Sign In for Pricing
View Details
Anti-Human FOLH1/PSMA Antibody (J591), PerCP
HC669147-01 1 Each

Anti-Human FOLH1/PSMA Antibody (J591), PerCP

Sign In for Pricing
View Details