Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGIT, Cynomolgus (HEK293, C-hFc)

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, C-hFc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TIGIT Protein, Cynomolgus (HEK293, C-hFc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tigit-protein-cynomolgus-hek-293-fc.html

Smiles

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Molecular Formula

102121588 (Gene_ID) G7NXM4/XP_015300911.1 (M89-P209) (Accession)

Molecular Weight

Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Neuregulins with an Ig-like domain are essential for mouse myocardial and neuronal development. Proc Natl Acad Sci U S A. 1996 May 14;93 (10) :4833-8.|[2]Hüttener M, et al. Roles of Proteins Containing Immunoglobulin-Like Domains in the Conjugation of Bacterial Plasmids. mSphere. 2022 Feb 23;7 (1) :e0097821.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FSCN (Fascin) ELISA Kit
EH25745 96 Tests

Human FSCN (Fascin) ELISA Kit

Sign In for Pricing
View Details
REXO2 shRNA Plasmid (m)
sc-152820-SH 20 µg

REXO2 shRNA Plasmid (m)

Sign In for Pricing
View Details
YM17E 5mg
A20229-5 5 mg

YM17E 5mg

Sign In for Pricing
View Details
Rat Galectin 12, Active Protein
RPU60443-01 50 µg

Rat Galectin 12, Active Protein

Sign In for Pricing
View Details
Rat Galectin 12, Active Protein
RPU60443-02 100 µg

Rat Galectin 12, Active Protein

Sign In for Pricing
View Details
Rat Galectin 12, Active Protein
RPU60443-03 1 mg

Rat Galectin 12, Active Protein

Sign In for Pricing
View Details