I-309/CCL1, Human (CHO)

I-309/CCL1 Protein, Human (CHO) is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Human (CHO) is a recombinant human CCL1 (K24-K96) expressed by CHO[1].

Product Specifications

Product Name Alternative

I-309/CCL1 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/i-309-ccl1-protein-human-cho.html

Purity

98.0

Smiles

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Molecular Formula

6346 (Gene_ID) P22362 (K24-K96) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Miller MD, et al. The human cytokine I-309 is a monocyte chemoattractant. Proc Natl Acad Sci U S A. 1992 Apr 1;89 (7) :2950-4.|[2]Roos RS, et al. Identification of CCR8, the receptor for the human CC chemokine I-309. J Biol Chem. 1997 Jul 11;272 (28) :17251-4.|[3]M D Miller, et al. The human cytokine I-309 is a monocyte chemoattractant. Proc Natl Acad Sci U S A. 1992 Apr 1;89 (7) :2950-4.|[4]A Zingoni, et al. The chemokine receptor CCR8 is preferentially expressed in Th2 but not Th1 cells. J Immunol. 1998 Jul 15;161 (2) :547-51.|[5]Gültekin Tamgüney, et al. Autocrine stimulation of rhadinovirus-transformed T cells by the chemokine CCL1/I-309. Oncogene. 2004 Nov 4;23 (52) :8475-85.|[6]Nasreen S Haque, et al. Chemokine receptor-8 (CCR8) mediates human vascular smooth muscle cell chemotaxis and metalloproteinase-2 secretion. Blood. 2004 Feb 15;103 (4) :1296-304.