Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Interleukin-10 (IL10)

Product Specifications

Product Name Alternative

IL-10; Cytokine synthesis inhibitory factor; CSIF

Abbreviation

Recombinant Rabbit IL10 protein

Gene Name

IL10

UniProt

Q9TSJ4

Expression Region

19-178aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

SRGQDTPAENSCIHFPGGLPHMLRELRAAFGRVKTFFQSKDQLNSMLLTESLLEDLKGYLGCQALSEMIQFYLKDVMPQAENHSPAIREHVNSLGENLKTLRLRLRQCHRFLPCENKSKAVEQVKSAFSKLQEEGVYKAMSEFDIFINYIETYMTMKIKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV2-U6-PCGF2-shRNA2-Puro Plasmid
PVT84523 2 µg

PLV2-U6-PCGF2-shRNA2-Puro Plasmid

Sign In for Pricing
View Details
Wilms Tumor Protein (FITC) discontinued
339727-01 50 µg

Wilms Tumor Protein (FITC) discontinued

Sign In for Pricing
View Details
Wilms Tumor Protein (FITC) discontinued
339727-02 100 µg

Wilms Tumor Protein (FITC) discontinued

Sign In for Pricing
View Details
Chicken Brain Natriuretic Peptide ELISA kit
GTR10469646 96 Well

Chicken Brain Natriuretic Peptide ELISA kit

Sign In for Pricing
View Details
Lentiviral human FKRP shRNA (UAS) - Lentiviral human FKRP shRNA (UAS, GFP) (25)
GTR15091964 1 Vial

Lentiviral human FKRP shRNA (UAS) - Lentiviral human FKRP shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
4- (1,3-Thiazol-2-ylcarbamoyl) benzeneboronic acid
OR1192-01 50 mg

4- (1,3-Thiazol-2-ylcarbamoyl) benzeneboronic acid

Sign In for Pricing
View Details