Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSNL1, Human (His)

VSNL1 mediates rhodopsin phosphorylation inhibition in vitro and its activity is dependent on calcium levels. This implies that VSNL1 plays a role in regulating rhodopsin phosphorylation dynamics, which is critical for photoreceptor cell signaling. VSNL1 Protein, Human (His) is the recombinant human-derived VSNL1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VSNL1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsnl1-protein-human-his.html

Purity

95.0

Smiles

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Molecular Formula

7447 (Gene_ID) P62760 (M1-K191) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif4b Antibody - C-terminal region : HRP (ARP61343_P050-HRP)
ARP61343_P050-HRP 100 µL

Eif4b Antibody - C-terminal region : HRP (ARP61343_P050-HRP)

Sign In for Pricing
View Details
GG6L4 rabbit pAb
MBS8601181-01 0.1 mL

GG6L4 rabbit pAb

Sign In for Pricing
View Details
GG6L4 rabbit pAb
MBS8601181-02 0.1 mL (AF405L)

GG6L4 rabbit pAb

Sign In for Pricing
View Details
GG6L4 rabbit pAb
MBS8601181-03 0.1 mL (AF405S)

GG6L4 rabbit pAb

Sign In for Pricing
View Details
GG6L4 rabbit pAb
MBS8601181-04 0.1 mL (AF610)

GG6L4 rabbit pAb

Sign In for Pricing
View Details
GG6L4 rabbit pAb
MBS8601181-05 0.1 mL (AF635)

GG6L4 rabbit pAb

Sign In for Pricing
View Details