Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSNL1, Human (His)

VSNL1 mediates rhodopsin phosphorylation inhibition in vitro and its activity is dependent on calcium levels. This implies that VSNL1 plays a role in regulating rhodopsin phosphorylation dynamics, which is critical for photoreceptor cell signaling. VSNL1 Protein, Human (His) is the recombinant human-derived VSNL1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VSNL1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsnl1-protein-human-his.html

Purity

95.0

Smiles

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Molecular Formula

7447 (Gene_ID) P62760 (M1-K191) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal anti-Human CD178 (Fas-L) Antibody
xAP-0144 100 µg

Mouse Monoclonal anti-Human CD178 (Fas-L) Antibody

Sign In for Pricing
View Details
Rabbit anti-Nav1.6 Antibody
DL91051A-01 50 µL

Rabbit anti-Nav1.6 Antibody

Sign In for Pricing
View Details
Rabbit anti-Nav1.6 Antibody
DL91051A-02 100 µL

Rabbit anti-Nav1.6 Antibody

Sign In for Pricing
View Details
Human NDUFS1 Protein Lysate 20ug
IHUNDUFS1PLLY20UG 20 µg

Human NDUFS1 Protein Lysate 20ug

Sign In for Pricing
View Details
Calpain 3/CAPN3 Rabbit Polyclonal Antibody (Fluoro594)
orb3111477 100 µg

Calpain 3/CAPN3 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Pkib (NM_001039051) Mouse Tagged ORF Clone
MR227740 10 µg

Pkib (NM_001039051) Mouse Tagged ORF Clone

Sign In for Pricing
View Details