Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIISOPROPYL AZODICARBOXYLATE

Product Specifications

No additional specifications available.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM16A Antibody
ASA-B1880 1 Each

TMEM16A Antibody

Sign In for Pricing
View Details
Porcine hormone sensitive lipase (HSL) ELISA Kit
QY-E40003 96 Tests

Porcine hormone sensitive lipase (HSL) ELISA Kit

Sign In for Pricing
View Details
Olr1364 (NM_001000858) Rat Tagged ORF Clone
RR202918 10 µg

Olr1364 (NM_001000858) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Villin 1 Antibody (VIL1/2376) [FITC]
NBP3-08928F 100 µL

Mouse Monoclonal Villin 1 Antibody (VIL1/2376) [FITC]

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
T76250-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
T76250-02 50 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details