Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GALNAC2, Human (HEK293, His)

The ST6GALNAC2 protein is an essential enzyme that catalyzes the transfer of N-acetylneuramidyl groups to glycan chains in glycoproteins. This glycosyltransferase shows a preference for N-acetylgalactosamine (GalNAc) residues that have been modified by the addition of galactose or galactose followed by the addition of sialic acid in an α-2,3 linkage. ST6GALNAC2 Protein, Human (HEK293, His) is the recombinant human-derived ST6GALNAC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ST6GALNAC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6galnac2-protein-human-hek-293-his.html

Purity

98.0

Smiles

SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR

Molecular Formula

10610 (Gene_ID) Q9UJ37 (S29-R374) (Accession)

Molecular Weight

Approximately 44.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O1:K1 / APEC Spermidine export protein MdtJ (mdtJ), partial
MBS7063171 Inquire

Recombinant Escherichia coli O1:K1 / APEC Spermidine export protein MdtJ (mdtJ), partial

Sign In for Pricing
View Details
T7 RNA Polymerase, GMP grade
GMP-10301-250K 1mL/250KU

T7 RNA Polymerase, GMP grade

Sign In for Pricing
View Details
Mouse Lysosome-associated membrane glycoprotein 2 (LAMP2) ELISA Kit
RK08170 96 Tests

Mouse Lysosome-associated membrane glycoprotein 2 (LAMP2) ELISA Kit

Sign In for Pricing
View Details
Cadm1 ORF Vector (Mouse) (pORF)
ORF040248 1.0 µg DNA

Cadm1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Kocuria rhizophila Bifunctional protein FolD (folD)
MBS1148798-01 0.02 mg (E-Coli)

Recombinant Kocuria rhizophila Bifunctional protein FolD (folD)

Sign In for Pricing
View Details
Recombinant Kocuria rhizophila Bifunctional protein FolD (folD)
MBS1148798-02 0.02 mg (Yeast)

Recombinant Kocuria rhizophila Bifunctional protein FolD (folD)

Sign In for Pricing
View Details