Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oligotropha carboxidovorans Triosephosphate isomerase (tpiA)

Product Specifications

CAS Number

9000-83-3

Gene Name

[tpiA]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[tpiA; TIM; TPI]

Short Name

[Triosephosphate isomerase (tpiA)]

Other Product Names

[triose-phosphate isomerase; Triosephosphate isomerase; Triose-phosphate isomerase]

NCBI GI Number

501558944

NCBI Accession Number

WP_012563441.1

NCBI GB Accession Number

WP_012563441.1

Uniprot Accession Number

B6JFZ2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERTAD1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2126804 1.0 µg DNA

SERTAD1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human GLRX Protein, N-His
E55P5861 50 µg

Recombinant Human GLRX Protein, N-His

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
MF-0155578-02 50 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
alpha 1 Antichymotrypsin (SERPINA3) (NM_001085) Human Untagged Clone
SC119471 10 µg

alpha 1 Antichymotrypsin (SERPINA3) (NM_001085) Human Untagged Clone

Sign In for Pricing
View Details
Monkey PKA ELISA Kit
EMKP0753 96 Tests

Monkey PKA ELISA Kit

Sign In for Pricing
View Details