Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (Biotin)
MBS6261611-01 0.1 mL

Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (Biotin)

Sign In for Pricing
View Details
Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (Biotin)
MBS6261611-02 5x 0.1 mL

Rotavirus VP6 (Rotavirus VP-6, Rotavirus VP-6, VP6) (Biotin)

Sign In for Pricing
View Details
VN1R27P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV755710 1.0 µg DNA

VN1R27P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Monoclonal Lgr5/GPR49 Antibody (750835) [mFluor Violet 500 SE]
FAB80781MFV500 0.1 mL

Mouse Monoclonal Lgr5/GPR49 Antibody (750835) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
pEnCMV-ITGB1-DT-204-SV40-Neo Plasmid
PVT43763 2 µg

pEnCMV-ITGB1-DT-204-SV40-Neo Plasmid

Sign In for Pricing
View Details
Human NRP2 Protein, His Tag
E33P101164 10 µg

Human NRP2 Protein, His Tag

Sign In for Pricing
View Details