Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP32 Rabbit Polyclonal Antibody
APRab19675-01 20 µL

USP32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP32 Rabbit Polyclonal Antibody
APRab19675-02 50 µL

USP32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP32 Rabbit Polyclonal Antibody
APRab19675-03 100 µL

USP32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP32 Rabbit Polyclonal Antibody
APRab19675-04 200 µL

USP32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gtf2f2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7024906 1.0 µg DNA

Gtf2f2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PADI2 antibody
70R-2589 50 ug

PADI2 antibody

Sign In for Pricing
View Details