Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Obscurin, Obscn ELISA KIT
ELI-21395m 96 Tests

Mouse Obscurin, Obscn ELISA KIT

Sign In for Pricing
View Details
Muscle RAS oncogene homolog
324723 100 µL

Muscle RAS oncogene homolog

Sign In for Pricing
View Details
CD48 (Antigen CD48, B cell Membrane Protein, B Lymphocyte Activation Marker BLAST 1 [Precursor], BCM1 Surface Antigen, BLAST1, hCD48, Leukocyte Antigen MEM 102, mCD48, MEM-102, SLAMF2, TCT.1) (MaxLight 650) discontinued
C2403-09R-ML650 100 µL

CD48 (Antigen CD48, B cell Membrane Protein, B Lymphocyte Activation Marker BLAST 1 [Precursor], BCM1 Surface Antigen, BLAST1, hCD48, Leukocyte Antigen MEM 102, mCD48, MEM-102, SLAMF2, TCT.1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal TRAP1 Antibody (3H4-2H6) [Alexa Fluor 647]
NBP2-59343AF647 100 µL

Mouse Monoclonal TRAP1 Antibody (3H4-2H6) [Alexa Fluor 647]

Sign In for Pricing
View Details
LRRC3C, CT (LRRC3C, Leucine-rich repeat-containing protein 3C) (Azide free) (HRP) discontinued
037956-HRP 200 µL

LRRC3C, CT (LRRC3C, Leucine-rich repeat-containing protein 3C) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Human Acid Phosphatase (ACP) ELISA Kit
GA-E0978HM-01 48 Tests

Human Acid Phosphatase (ACP) ELISA Kit

Sign In for Pricing
View Details