Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTD1 (NM_080820) Human Recombinant Protein
TP307233M 100 µg

DTD1 (NM_080820) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal ECH1 Antibody [Biotin]
NBP3-00324B 0.1 mL

Rabbit Polyclonal ECH1 Antibody [Biotin]

Sign In for Pricing
View Details
Rabbit Polyclonal POLR1C Antibody
NBP3-35071-20ul 20 µL

Rabbit Polyclonal POLR1C Antibody

Sign In for Pricing
View Details
RNU7 sgRNA CRISPR Lentivector set (Human)
K1854601 3x 1.0 µg

RNU7 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Caprisil NH2 HPLC Column, 5 µm, 100 Å, CE553-A x 250 mm
CE453-A 5 µm

Caprisil NH2 HPLC Column, 5 µm, 100 Å, CE553-A x 250 mm

Sign In for Pricing
View Details
Canine Prostaglandin H2 ELISA Kit
MBS751767-01 48 Well

Canine Prostaglandin H2 ELISA Kit

Sign In for Pricing
View Details