Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Impg2 ELISA Kit
EF015278 96 Tests

Mouse Impg2 ELISA Kit

Sign In for Pricing
View Details
Canine OBTF4 ELISA Kit
ECO0015 96 Tests

Canine OBTF4 ELISA Kit

Sign In for Pricing
View Details
Olfr1138 Mouse qPCR Primer Pair (NM_146639)
MP209374 200 Reactions

Olfr1138 Mouse qPCR Primer Pair (NM_146639)

Sign In for Pricing
View Details
Lentiviral human C19orf25 shRNA (UAS) - Lentiviral human C19orf25 shRNA (UAS, GFP) (100)
GTR15088377 1 Vial

Lentiviral human C19orf25 shRNA (UAS) - Lentiviral human C19orf25 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
AQP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0109008 1.0 µg DNA

AQP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Ovgp1 (NM_007696) Mouse Tagged ORF Clone
MG221693 10 µg

Ovgp1 (NM_007696) Mouse Tagged ORF Clone

Sign In for Pricing
View Details