Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL20 Protein Vector (Rat) (pPM-C-HA)
PV267940 500 ng

FBXL20 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
SQSTM1 (NM_001142298) Human 3' UTR Clone
SC214937 10 µg

SQSTM1 (NM_001142298) Human 3' UTR Clone

Sign In for Pricing
View Details
IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (HRP)
128469-HRP 100 µL

IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (HRP)

Sign In for Pricing
View Details
Ltb4r2 Mouse shRNA Lentiviral Particle (Locus ID 57260)
TL503293V 500 µL Each

Ltb4r2 Mouse shRNA Lentiviral Particle (Locus ID 57260)

Sign In for Pricing
View Details
Paxillin (BSA & Azide Free) (PXN) (APC) discontinued
P3113-86X-APC 100 µL

Paxillin (BSA & Azide Free) (PXN) (APC) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal CASC5 Antibody [Janelia Fluor 549]
NB100-2586JF549 0.1 mL

Rabbit Polyclonal CASC5 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details