Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf57 Protein Vector (Human) (pPM-N-D-C-HA)
PV330788 500 ng

C2orf57 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Myristic acid, Hi-LR™
GRM830-500G 1 unit

Myristic acid, Hi-LR™

Sign In for Pricing
View Details
Vezt sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7254006 1.0 µg DNA

Vezt sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal mpp8 Antibody
NBP1-92135 0.1 mL

Rabbit Polyclonal mpp8 Antibody

Sign In for Pricing
View Details
TRNAS24 CRISPR Knock Out 293T Cell Line (Human)
48380141 1x 10^6 Cells / 1.0 mL

TRNAS24 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 750) discontinued
252533-ML750 100 µL

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 750) discontinued

Sign In for Pricing
View Details