Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat F(ab')2 anti-Mouse IgG1 Heavy Chain Antibody
abx401534-01 0.5 mg

Goat F(ab')2 anti-Mouse IgG1 Heavy Chain Antibody

Sign In for Pricing
View Details
Goat F(ab')2 anti-Mouse IgG1 Heavy Chain Antibody
abx401534-02 100 µg

Goat F(ab')2 anti-Mouse IgG1 Heavy Chain Antibody

Sign In for Pricing
View Details
Rabbit anti-SSRP1 Antibody
YLD7401-01 50 µL

Rabbit anti-SSRP1 Antibody

Sign In for Pricing
View Details
Rabbit anti-SSRP1 Antibody
YLD7401-02 100 µL

Rabbit anti-SSRP1 Antibody

Sign In for Pricing
View Details
Human CABCOCO1 Pre-designed siRNA Set B
SI002050B 1 Each

Human CABCOCO1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
VSIG4 Human shRNA Plasmid Kit (Locus ID 11326)
TG308400 1 Kit

VSIG4 Human shRNA Plasmid Kit (Locus ID 11326)

Sign In for Pricing
View Details