Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody
TA374758 100 µL

Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DEFB112, NT (DEFB112, DEFB12, Beta-defensin 112, Beta-defensin 12, Defensin, beta 112) (Azide free) (HRP) discontinued
034573-HRP 200 µL

DEFB112, NT (DEFB112, DEFB12, Beta-defensin 112, Beta-defensin 12, Defensin, beta 112) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Nicotinic Acetylcholine Receptor beta 2 Antibody
NBP2-82289-0.1mL 0.1 mL

Rabbit Polyclonal Nicotinic Acetylcholine Receptor beta 2 Antibody

Sign In for Pricing
View Details
Tas2r138 AAV siRNA Pooled Vector
46172164 1.0 µg

Tas2r138 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Monoclonal Factor VIII:c heavy chain Antibody (RFF-VIII:c/10) [DyLight 680]
NBP2-53119FR 0.1 mL

Mouse Monoclonal Factor VIII:c heavy chain Antibody (RFF-VIII:c/10) [DyLight 680]

Sign In for Pricing
View Details
Ala-Leu-Ala-Leu
GWB-5C9464 1 mg

Ala-Leu-Ala-Leu

Sign In for Pricing
View Details