Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf63 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0312507 1.0 µg DNA

C16orf63 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
VPS37B shRNA Plasmid (m)
sc-155220-SH 20 µg

VPS37B shRNA Plasmid (m)

Sign In for Pricing
View Details
Tesp2 AAV Vector (Rat) (CMV)
46514106 1 µg

Tesp2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
EEF1A2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0655103 1.0 µg DNA

EEF1A2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Thymosin Beta 4 (TMSB4X)
MBS2168784-01 0.1 mL

FITC-Linked Polyclonal Antibody to Thymosin Beta 4 (TMSB4X)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Thymosin Beta 4 (TMSB4X)
MBS2168784-02 0.2 mL

FITC-Linked Polyclonal Antibody to Thymosin Beta 4 (TMSB4X)

Sign In for Pricing
View Details