Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Anti-DPP10 Antibody (Internal)
TA341253 50 µg

Rabbit Polyclonal Anti-DPP10 Antibody (Internal)

Sign In for Pricing
View Details
SERPINI1, NT (SERPINI1, PI12, Neuroserpin, Peptidase inhibitor 12, Serpin I1) (FITC) discontinued
041591-FITC 200 µL

SERPINI1, NT (SERPINI1, PI12, Neuroserpin, Peptidase inhibitor 12, Serpin I1) (FITC) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Exosc1 shRNA (UAS) - Lentiviral mouse Exosc1 shRNA (UAS, GFP) plasmid
GTR15114118 1 Vial

Lentiviral mouse Exosc1 shRNA (UAS) - Lentiviral mouse Exosc1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral human CLTCL1 sgRNA gene knockout kit - Lentiviral human CLTCL1 sgRNA gene knockout kit (plasmid)
GTR15370337 1 Vial

Lentiviral human CLTCL1 sgRNA gene knockout kit - Lentiviral human CLTCL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Olfr532 (NM_147026) Mouse Tagged ORF Clone Lentiviral Particle
MR214031L4V 200 µL

Olfr532 (NM_147026) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRIM10 Protein Vector (Mouse) (pPM-C-His)
PV241389 500 ng

TRIM10 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details