Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmed4 siRNA Oligos set (Rat)
46844176 3x 5 nmol

Tmed4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human HRAS Antibody
ANT-35994-100ug 100 µg

Human HRAS Antibody

Sign In for Pricing
View Details
RPP40 3'UTR GFP Stable Cell Line
TU071664 1.0 mL

RPP40 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
POLR3H Human qPCR Template Standard (NM_138338)
HK211646 1 Kit

POLR3H Human qPCR Template Standard (NM_138338)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) GLGS Polyclonal Antibody
MBS7175906 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) GLGS Polyclonal Antibody

Sign In for Pricing
View Details
TNR Antibody
A50975-50UG 50 µg

TNR Antibody

Sign In for Pricing
View Details