Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal RENT1/UPF1/hUPF1 Antibody [PE]
NB100-370PE 0.1 mL

Goat Polyclonal RENT1/UPF1/hUPF1 Antibody [PE]

Sign In for Pricing
View Details
LOC686032 ORF Vector (Rat) (pORF)
ORF069821 1.0 µg DNA

LOC686032 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
FGR (NM_005248) Human Tagged Lenti ORF Clone
RC214458L2 10 µg

FGR (NM_005248) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phenoxodiol 10mg
A21147-10 10 mg

Phenoxodiol 10mg

Sign In for Pricing
View Details
Usilnetug Biosimilar - Research Grade
ICH5963-20mg 20 mg

Usilnetug Biosimilar - Research Grade

Sign In for Pricing
View Details
OGFOD2 siRNA (Human)
CRJ2479-01 15 nmol

OGFOD2 siRNA (Human)

Sign In for Pricing
View Details