Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal B7-1/CD80 Antibody (2D10.4) [Allophycocyanin]
NBP1-43384APC 0.1 mL

Mouse Monoclonal B7-1/CD80 Antibody (2D10.4) [Allophycocyanin]

Sign In for Pricing
View Details
BCAT2 (NM_001164773) Human Untagged Clone
SC326869 10 µg

BCAT2 (NM_001164773) Human Untagged Clone

Sign In for Pricing
View Details
GENLISA™ Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) ELISA
KBH2299 1x 96 Well

GENLISA™ Human Leukocyte Associated Immunoglobulin Like Receptor 2 (LAIR2) ELISA

Sign In for Pricing
View Details
Stt3a Mouse qPCR Primer Pair (NM_008408)
MP216343 200 Reactions

Stt3a Mouse qPCR Primer Pair (NM_008408)

Sign In for Pricing
View Details
CD19 Antibody (Biotin)
GWB-525891 0.1 mg

CD19 Antibody (Biotin)

Sign In for Pricing
View Details
Anti-IL-1 beta Antibody
CQA9064-01 30 µL

Anti-IL-1 beta Antibody

Sign In for Pricing
View Details