Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
EKU08105 96 Tests

Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human C17orf49 shRNA (UAS) - Lentiviral human C17orf49 shRNA (UAS, GFP) (25)
GTR15082328 1 Vial

Lentiviral human C17orf49 shRNA (UAS) - Lentiviral human C17orf49 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Interleukin-17 Receptor A (IL17RA, IL-17RA, CDw217, CD217, MGC10262, AW538159) (FITC)
MBS6309962-01 0.2 mL

Interleukin-17 Receptor A (IL17RA, IL-17RA, CDw217, CD217, MGC10262, AW538159) (FITC)

Sign In for Pricing
View Details
Interleukin-17 Receptor A (IL17RA, IL-17RA, CDw217, CD217, MGC10262, AW538159) (FITC)
MBS6309962-02 5x 0.2 mL

Interleukin-17 Receptor A (IL17RA, IL-17RA, CDw217, CD217, MGC10262, AW538159) (FITC)

Sign In for Pricing
View Details
SLC22A6 AAV Vector (Human) (CMV)
43963101 1 µg

SLC22A6 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Kif22 3'UTR Luciferase Stable Cell Line
TU110559 1.0 mL

Kif22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details