Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR5A2 (Nuclear Receptor Subfamily 5 Group A Member 2, Alpha-1-Fetoprotein Transcription Factor, B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2, FTZ-F1beta) (MaxLight 405)
MBS6429691-01 0.1 mL

NR5A2 (Nuclear Receptor Subfamily 5 Group A Member 2, Alpha-1-Fetoprotein Transcription Factor, B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2, FTZ-F1beta) (MaxLight 405)

Sign In for Pricing
View Details
NR5A2 (Nuclear Receptor Subfamily 5 Group A Member 2, Alpha-1-Fetoprotein Transcription Factor, B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2, FTZ-F1beta) (MaxLight 405)
MBS6429691-02 5x 0.1 mL

NR5A2 (Nuclear Receptor Subfamily 5 Group A Member 2, Alpha-1-Fetoprotein Transcription Factor, B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2, FTZ-F1beta) (MaxLight 405)

Sign In for Pricing
View Details
Lentiviral mouse Pafah2 shRNA (UAS) - Lentiviral mouse Pafah2 shRNA (UAS, iRFP) (100)
GTR15167727 1 Vial

Lentiviral mouse Pafah2 shRNA (UAS) - Lentiviral mouse Pafah2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human RCAN2 Knockout A549 cell line
GTR15411898 1 Vial

Human RCAN2 Knockout A549 cell line

Sign In for Pricing
View Details
Anti-Carbonic anhydrase II Antibody, Rabbit Polyclonal
MBS8102945-01 0.1 mL

Anti-Carbonic anhydrase II Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Carbonic anhydrase II Antibody, Rabbit Polyclonal
MBS8102945-02 5x 0.1 mL

Anti-Carbonic anhydrase II Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details