Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Siglec-2 Llamabody VHH Alexa Fluor 750 MAb L007.2.5N
LFAB10732S-100UG 100 µg

Human Siglec-2 Llamabody VHH Alexa Fluor 750 MAb L007.2.5N

Sign In for Pricing
View Details
Cyclin D2 (CCND2) Mouse Monoclonal Antibody [Clone ID: OTI1E4]
TA806252 100 µL

Cyclin D2 (CCND2) Mouse Monoclonal Antibody [Clone ID: OTI1E4]

Sign In for Pricing
View Details
Mouse Monoclonal TRAF-1 Antibody (TRAF1/3299) [Alexa Fluor 594]
NBP3-27023AF594 0.1 mL

Mouse Monoclonal TRAF-1 Antibody (TRAF1/3299) [Alexa Fluor 594]

Sign In for Pricing
View Details
NAT8 Human siRNA Oligo Duplex (Locus ID 9027)
SR322625 1 Kit

NAT8 Human siRNA Oligo Duplex (Locus ID 9027)

Sign In for Pricing
View Details
Human FHL2 Affinity Purified Polyclonal Ab
AF4758 100 µg

Human FHL2 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Lentiviral human PHOSPHO1 shRNA (UAS) - Lentiviral human PHOSPHO1 shRNA (UAS) (100)
GTR15128910 1 Vial

Lentiviral human PHOSPHO1 shRNA (UAS) - Lentiviral human PHOSPHO1 shRNA (UAS) (100)

Sign In for Pricing
View Details