Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL6, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

INSL6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl6-protein-human-hek293-his.html

Purity

95.0

Smiles

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Molecular Formula

11172 (Gene_ID) Q9Y581/NP_009110.2 (R21-F198) (Accession)

Molecular Weight

Approximately 28-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Factor 1 (NFIA) (NM_001134673) Human Tagged ORF Clone
RG225878 10 µg

Nuclear Factor 1 (NFIA) (NM_001134673) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal DR6/TNFRSF21 Antibody (001) [HRP]
NBP2-89313H 0.1 mL

Rabbit Monoclonal DR6/TNFRSF21 Antibody (001) [HRP]

Sign In for Pricing
View Details
ANKRD23 siRNA (Human)
CRJ6254-01 15 nmol

ANKRD23 siRNA (Human)

Sign In for Pricing
View Details
ANKRD23 siRNA (Human)
CRJ6254-02 30 nmol

ANKRD23 siRNA (Human)

Sign In for Pricing
View Details
Mitochondrial chaperone BCS1 (BCS1L) Human ELISA Kit
F0222 96 Tests

Mitochondrial chaperone BCS1 (BCS1L) Human ELISA Kit

Sign In for Pricing
View Details
Tau
336598-01 50 µg

Tau

Sign In for Pricing
View Details