Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf76 (C8orf76)

Product Specifications

Abbreviation

Recombinant Human C8orf76 protein

Gene Name

C8orf76

UniProt

Q96K31

Expression Region

1-380aa

Organism

Homo sapiens (Human)

Target Sequence

MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Macrophage Calyculin A Control Lysate
MBS474118-01 0.1 mL

Mouse Macrophage Calyculin A Control Lysate

Sign In for Pricing
View Details
Mouse Macrophage Calyculin A Control Lysate
MBS474118-02 5x 0.1 mL

Mouse Macrophage Calyculin A Control Lysate

Sign In for Pricing
View Details
Rat Rab34 ELISA Kit
ELI-36018r 96 Tests

Rat Rab34 ELISA Kit

Sign In for Pricing
View Details
LPIN3 sgRNA CRISPR Lentivector (Human) (Target 1)
K1227302 1.0 µg DNA

LPIN3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
HBP1 (NM_012257) Human Tagged Lenti ORF Clone
RC202260L2 10 µg

HBP1 (NM_012257) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Foxf1a 3'UTR Luciferase Stable Cell Line
TU106683 1.0 mL

Foxf1a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details