Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EB3/MAPRE3, Human (His)

The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

EB3/MAPRE3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eb3-protein-human-his.html

Purity

95.20

Smiles

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Molecular Formula

22924 (Gene_ID) Q9UPY8-1 (M1-Y281) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (BRA-11G), CF488A conjugate, 0.1mg/mL
BNC880174-100 1x 100 µL

CD45RB (BRA-11G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SCmL4 activation kit by CRISPRa
GA116861 1 Kit

Human SCmL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CNDP1 Protein (His Tag)
PKSH031891 50 µg

Recombinant Human CNDP1 Protein (His Tag)

Sign In for Pricing
View Details
Pipette Tips BPIC-402
BPIC-402 1 Unit

Pipette Tips BPIC-402

Sign In for Pricing
View Details
HIBCH (NM_014362) Human Over-expression Lysate
LC402324 20 µg

HIBCH (NM_014362) Human Over-expression Lysate

Sign In for Pricing
View Details
ASS1 Antibody
KC-1138-01 50 μL

ASS1 Antibody

Sign In for Pricing
View Details