Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EB3/MAPRE3, Human (His)

The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

EB3/MAPRE3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eb3-protein-human-his.html

Purity

95.20

Smiles

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Molecular Formula

22924 (Gene_ID) Q9UPY8-1 (M1-Y281) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA2 Antibody
8C10682-AAT 50 µg

BRCA2 Antibody

Sign In for Pricing
View Details
Sgpp1 Mouse Gene Knockout Kit (CRISPR)
KN515688 1 Kit

Sgpp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-threo-Hex-2-enaric acid 1,4-Lactone Dihydrate Tripotassium Salt
TRC-H294838-50MG 50 mg

L-threo-Hex-2-enaric acid 1,4-Lactone Dihydrate Tripotassium Salt

Sign In for Pricing
View Details
1-(2-Furyl)ethanol
TRC-F865260-500MG 500 mg

1-(2-Furyl)ethanol

Sign In for Pricing
View Details
RRP12 Polyclonal Antibody
E-AB-90626-01 60 µL

RRP12 Polyclonal Antibody

Sign In for Pricing
View Details
RRP12 Polyclonal Antibody
E-AB-90626-02 120 µL

RRP12 Polyclonal Antibody

Sign In for Pricing
View Details