Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EB3/MAPRE3, Human (His)

The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

EB3/MAPRE3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eb3-protein-human-his.html

Purity

95.20

Smiles

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Molecular Formula

22924 (Gene_ID) Q9UPY8-1 (M1-Y281) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK25 Antibody
CSB-PA022842LA01HU-01 50 µg

STK25 Antibody

Sign In for Pricing
View Details
STK25 Antibody
CSB-PA022842LA01HU-02 100 µg

STK25 Antibody

Sign In for Pricing
View Details
GCNT1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21391064 1.0 µg DNA

GCNT1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KCNH6 Peptide
MBS3227583-01 0.1 mg

KCNH6 Peptide

Sign In for Pricing
View Details
KCNH6 Peptide
MBS3227583-02 5x 0.1 mg

KCNH6 Peptide

Sign In for Pricing
View Details
ABH8 Rabbit pAb, PE-Cy5 conjugated
orb2882429 100 µL

ABH8 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details