Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-1 alpha/REG1A, Human (HEK293, His)

REG1A Protein inhibits spontaneous calcium carbonate precipitation and is linked to neuronal sprouting in the brain. Additionally, it contributes to the regeneration of brain and pancreas tissues. REG-1 alpha/REG1A Protein, Human (HEK293, His) is the recombinant human-derived REG-1 alpha/REG1A protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

REG-1 alpha/REG1A Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg-1-alpha-protein-human-hek-293-his.html

Purity

95.0

Smiles

QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

Molecular Formula

5967 (Gene_ID) P05451 (Q23-N166) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS13D Lentiviral Activation Particles (h)
sc-406990-LAC 200 µL

VPS13D Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
HEPACAM Polyclonal Antibody, Cy7 Conjugated
bs-5840R-Cy7 100 µL

HEPACAM Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Calbindin Recombinant Rabbit monoclonal Antibody
IRS221RB 50 Tests

Calbindin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
IGHV3-29 3'UTR Luciferase Stable Cell Line
TU010653 1.0 mL

IGHV3-29 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PI3-Kinase p110 beta Recombinant Rabbit mAb
BS45272-01 50 µL

PI3-Kinase p110 beta Recombinant Rabbit mAb

Sign In for Pricing
View Details
PI3-Kinase p110 beta Recombinant Rabbit mAb
BS45272-02 100 µL

PI3-Kinase p110 beta Recombinant Rabbit mAb

Sign In for Pricing
View Details