Lymphocyte antigen 6C1/LY6C1, Mouse (P.pastoris, His)
Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity.Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway.Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Lymphocyte antigen 6C1/LY6C1 protein, expressed by P.pastoris , with N-6*His labeled tag.
Product Specifications
CAS Number
[9007-83-4]
Product Name Alternative
Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ly6c-protein-mouse-p-pastoris-his.html
Smiles
LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Molecular Formula
17067 (Gene_ID) P0CW02 (L27-G109) (Accession)
Molecular Weight
Approximately 25.1 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Human PDGFRβ (Platelet Derived Growth Factor Receptor Beta) ELISA Kit
Human PDGFRβ (Platelet Derived Growth Factor Receptor Beta) ELISA Kit
NFKBIA, Phosphorylated (Ser32) (NFKBIA, IKBA, MAD3, NFKBI, NF-kappa-B inhibitor alpha, I-kappa-B-alpha, Major histocompatibility complex enhancer-binding protein MAD3) (AP)
NFKBIA, Phosphorylated (Ser32) (NFKBIA, IKBA, MAD3, NFKBI, NF-kappa-B inhibitor alpha, I-kappa-B-alpha, Major histocompatibility complex enhancer-binding protein MAD3) (AP)