Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTN, Human (His)

The TTN protein is critical for vertebrate striated muscle assembly, establishing microfilament connections that are critical for sarcomeric force balance. TTN coordinates cross-link size and extensibility, shaping sarcomere extensibility and muscle function. TTN Protein, Human (His) is the recombinant human-derived TTN protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TTN Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ttn-protein-human-his.html

Smiles

VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT

Molecular Formula

7273 (Gene_ID) Q8WZ42 (V5398-T5604) (Accession)

Molecular Weight

Approximately 26.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

W100, wide-neck cryogenic freezer, liquid phase storage
2131000 1 Each

W100, wide-neck cryogenic freezer, liquid phase storage

Ask
View Details
4-Chloro-2-formylphenylboronic Acid Pinacol Ester
431504-01 100 mg

4-Chloro-2-formylphenylboronic Acid Pinacol Ester

Ask
View Details
4-Chloro-2-formylphenylboronic Acid Pinacol Ester
431504-02 250 mg

4-Chloro-2-formylphenylboronic Acid Pinacol Ester

Ask
View Details
Human P2RY12 (Purinergic Receptor P2Y, G Protein Coupled 12) ELISA Kit
MBS8803385-01 48 Well

Human P2RY12 (Purinergic Receptor P2Y, G Protein Coupled 12) ELISA Kit

Ask
View Details
Human P2RY12 (Purinergic Receptor P2Y, G Protein Coupled 12) ELISA Kit
MBS8803385-02 96 Well

Human P2RY12 (Purinergic Receptor P2Y, G Protein Coupled 12) ELISA Kit

Ask
View Details
Human P2RY12 (Purinergic Receptor P2Y, G Protein Coupled 12) ELISA Kit
MBS8803385-03 5x 96 Well

Human P2RY12 (Purinergic Receptor P2Y, G Protein Coupled 12) ELISA Kit

Ask
View Details