Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Hemoglobin subunit beta (HBB)

Product Specifications

Product Name Alternative

Beta-globin; Hemoglobin beta chain

Abbreviation

Recombinant Cynomolgus monkey HBB protein

Gene Name

HBB

UniProt

P68223

Expression Region

2-147aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

VHLTPEEKNAVTTLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in oxygen transport from the lung to the various peripheral tissues.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CSKMT shRNA (UAS) - Lentiviral human CSKMT shRNA (UAS, GFP) plasmid
GTR15321589 1 Vial

Lentiviral human CSKMT shRNA (UAS) - Lentiviral human CSKMT shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Fam70b 3'UTR Luciferase Stable Cell Line
TU204398 1.0 mL

Fam70b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GMPR2 (GMP Reductase 2, Guanosine 5'-monophosphate Oxidoreductase 2, Guanosine Monophosphate Reductase 2) (MaxLight 650)
MBS6380008-01 0.1 mL

GMPR2 (GMP Reductase 2, Guanosine 5'-monophosphate Oxidoreductase 2, Guanosine Monophosphate Reductase 2) (MaxLight 650)

Sign In for Pricing
View Details
GMPR2 (GMP Reductase 2, Guanosine 5'-monophosphate Oxidoreductase 2, Guanosine Monophosphate Reductase 2) (MaxLight 650)
MBS6380008-02 5x 0.1 mL

GMPR2 (GMP Reductase 2, Guanosine 5'-monophosphate Oxidoreductase 2, Guanosine Monophosphate Reductase 2) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Protein L5 (VACWR092)
orb2932840-01 20 µg

Recombinant Vaccinia virus Protein L5 (VACWR092)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Protein L5 (VACWR092)
orb2932840-02 100 µg

Recombinant Vaccinia virus Protein L5 (VACWR092)

Sign In for Pricing
View Details