Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Human

IL-3 Protein, Human is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. IL-3 Protein, Human plays a role in neural cell proliferation and survival. IL-3 Protein, Human inhibits NF-κB nuclear translocation and activation, and inhibits osteoclast differentiation. IL-3 Protein, Human is the recombinant human-derived IL-2 Protein, expressed by E. coli.

Product Specifications

Product Name Alternative

IL-3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-human.html

Purity

98.00

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 15.2 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.|[3]Santoli D, et al., Amplification of IL-2-driven T cell proliferation by recombinant human IL-3 and granulocyte-macrophage colony-stimulating factor. J Immunol.|[4]Mayer P, et al. The in vivo effects of recombinant human interleukin-3: demonstration of basophil differentiation factor, histamine-producing activity, and priming of GM-CSF-responsive progenitors in nonhuman primates[J]. 1989.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shroom4 3'UTR Luciferase Stable Cell Line
TU220349 1.0 mL

Shroom4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-NGL-3/LRRC4B Antibody
75-085 100 µL

Anti-NGL-3/LRRC4B Antibody

Sign In for Pricing
View Details
Lentiviral human SETD9 shRNA (UAS) - Lentiviral human SETD9 shRNA (UAS) (100)
GTR15105342 1 Vial

Lentiviral human SETD9 shRNA (UAS) - Lentiviral human SETD9 shRNA (UAS) (100)

Sign In for Pricing
View Details
IKBK-epsilon (I kappa B Kinase epsilon, I-kappa-B Kinase epsilon, IkBKE, IKBKE Protein, IKK E, IKK i, IKK Related Kinase epsilon, IKK-E, IKK-epsilon, IKK-i, IKKE, IKKE, IKKepsilon, IKKI, Inducible I kappa B Kinase, Inducible I kappa-B Kinase, inducible IkappaB Kinase, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase epsilon, Inhibitor of Nuclear Factor kappa B Kinase Subunit epsilon, Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, KIAA0151, MGC125294, MGC125295, MGC125297) discontinued
223516-01 50 µL

IKBK-epsilon (I kappa B Kinase epsilon, I-kappa-B Kinase epsilon, IkBKE, IKBKE Protein, IKK E, IKK i, IKK Related Kinase epsilon, IKK-E, IKK-epsilon, IKK-i, IKKE, IKKE, IKKepsilon, IKKI, Inducible I kappa B Kinase, Inducible I kappa-B Kinase, inducible IkappaB Kinase, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase epsilon, Inhibitor of Nuclear Factor kappa B Kinase Subunit epsilon, Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, KIAA0151, MGC125294, MGC125295, MGC125297) discontinued

Sign In for Pricing
View Details
IKBK-epsilon (I kappa B Kinase epsilon, I-kappa-B Kinase epsilon, IkBKE, IKBKE Protein, IKK E, IKK i, IKK Related Kinase epsilon, IKK-E, IKK-epsilon, IKK-i, IKKE, IKKE, IKKepsilon, IKKI, Inducible I kappa B Kinase, Inducible I kappa-B Kinase, inducible IkappaB Kinase, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase epsilon, Inhibitor of Nuclear Factor kappa B Kinase Subunit epsilon, Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, KIAA0151, MGC125294, MGC125295, MGC125297) discontinued
223516-02 100 µL

IKBK-epsilon (I kappa B Kinase epsilon, I-kappa-B Kinase epsilon, IkBKE, IKBKE Protein, IKK E, IKK i, IKK Related Kinase epsilon, IKK-E, IKK-epsilon, IKK-i, IKKE, IKKE, IKKepsilon, IKKI, Inducible I kappa B Kinase, Inducible I kappa-B Kinase, inducible IkappaB Kinase, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase epsilon, Inhibitor of Nuclear Factor kappa B Kinase Subunit epsilon, Inhibitor of Nuclear Factor kappa-B Kinase Subunit epsilon, KIAA0151, MGC125294, MGC125295, MGC125297) discontinued

Sign In for Pricing
View Details
B3GAT1 Recombinant Protein (Human)
RP048199 100 µg

B3GAT1 Recombinant Protein (Human)

Sign In for Pricing
View Details