Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Human

IL-3 Protein, Human is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. IL-3 Protein, Human plays a role in neural cell proliferation and survival. IL-3 Protein, Human inhibits NF-κB nuclear translocation and activation, and inhibits osteoclast differentiation. IL-3 Protein, Human is the recombinant human-derived IL-2 Protein, expressed by E. coli.

Product Specifications

Product Name Alternative

IL-3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-human.html

Purity

98.00

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 15.2 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.|[3]Santoli D, et al., Amplification of IL-2-driven T cell proliferation by recombinant human IL-3 and granulocyte-macrophage colony-stimulating factor. J Immunol.|[4]Mayer P, et al. The in vivo effects of recombinant human interleukin-3: demonstration of basophil differentiation factor, histamine-producing activity, and priming of GM-CSF-responsive progenitors in nonhuman primates[J]. 1989.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentafluorobenzenesulfonyl chloride 99%
P02880-01 1 g

Pentafluorobenzenesulfonyl chloride 99%

Sign In for Pricing
View Details
Pentafluorobenzenesulfonyl chloride 99%
P02880-02 5 g

Pentafluorobenzenesulfonyl chloride 99%

Sign In for Pricing
View Details
Pentafluorobenzenesulfonyl chloride 99%
P02880-03 25 g

Pentafluorobenzenesulfonyl chloride 99%

Sign In for Pricing
View Details
Zbed6-set siRNA/shRNA/RNAi Lentivector (Mouse)
50681094 4x 500 ng

Zbed6-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
MafB Antibody
ABD8895 100 µg

MafB Antibody

Sign In for Pricing
View Details
Pdhb (NM_024221) Mouse Tagged ORF Clone Lentiviral Particle
MR205484L4V 200 µL

Pdhb (NM_024221) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details