Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDR2 Double Nickase Plasmid (m2)

Product Specifications

No additional specifications available.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Telomerase ELISA Kit
OM619169 96 Strip Well

Sheep Telomerase ELISA Kit

Sign In for Pricing
View Details
Fabp12 sgRNA CRISPR Lentivector set (Mouse)
K3540301 3x 1.0 µg

Fabp12 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Pfn4 shRNA (UAS) - Lentiviral mouse Pfn4 shRNA (UAS, iRFP) (100)
GTR15246255 1 Vial

Lentiviral mouse Pfn4 shRNA (UAS) - Lentiviral mouse Pfn4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
LINC00163 Protein Vector (Human) (pPB-N-His)
PV091015 500 ng

LINC00163 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) Recombinant, Rat
155489-01 10 µg

Kallikrein 1 (KLK1) Recombinant, Rat

Sign In for Pricing
View Details