Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHA, Human (His)

LDHA protein catalyzes the stereospecific interconversion of pyruvate and lactate, concomitantly exchanging NADH and NAD (+) . LDHA Protein, Human (His) is the recombinant human-derived LDHA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LDHA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ldh-a-protein-human-his.html

Purity

98.0

Smiles

MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Molecular Formula

3939 (Gene_ID) P00338-1 (M1-F332) (Accession)

Molecular Weight

Approximately 34.0-38.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF711 Peptide
DF16050-BP 1 mg

ZNF711 Peptide

Sign In for Pricing
View Details
Rbm10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38593114 3x 1.0 µg

Rbm10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RGR Recombinant Protein (Human)
RP026287 100 µg

RGR Recombinant Protein (Human)

Sign In for Pricing
View Details
Porcine Heat Shock Protein 27 Antibody ELISA Kit
MBS746655-01 48 Well

Porcine Heat Shock Protein 27 Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Protein 27 Antibody ELISA Kit
MBS746655-02 96 Well

Porcine Heat Shock Protein 27 Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Protein 27 Antibody ELISA Kit
MBS746655-03 5x 96 Well

Porcine Heat Shock Protein 27 Antibody ELISA Kit

Sign In for Pricing
View Details