Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Chorismate synthase, chloroplastic (EMB1144)

Product Specifications

CAS Number

9000-83-3

Gene Name

[EMB1144]

NCBI Gene ID

841307

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[EMB1144; EMB1144; embryo defective 1144; T24P22.3; T24P22_3]

Short Name

[Chorismate synthase, chloroplastic (EMB1144)]

Other Product Names

[chorismate synthase, putative / 5-enolpyruvylshikimate-3-phosphate phospholyase; Chorismate synthase, chloroplastic; chorismate synthase, putative / 5-enolpyruvylshikimate-3-phosphate phospholyase; 5-enolpyruvylshikimate-3-phosphate phospholyase; Protein EMBRYO DEFECTIVE 1144]

NCBI GI Number

18402389

NCBI Accession Number

NP_564534.1

NCBI GB Accession Number

NM_103779.5

Uniprot Accession Number

P57720

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial Respiratory Chain Complex IV Activity Assay Kit (Visible Spectrophotometry)
MF-0001348 25 Tests

Mitochondrial Respiratory Chain Complex IV Activity Assay Kit (Visible Spectrophotometry)

Sign In for Pricing
View Details
Lentiviral human CCT2 shRNA (UAS) - Lentiviral human CCT2 shRNA (UAS, GFP) (25)
GTR15326603 1 Vial

Lentiviral human CCT2 shRNA (UAS) - Lentiviral human CCT2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
AdmiRa-mmu-mir-130c Virus
mm0898 250 µL

AdmiRa-mmu-mir-130c Virus

Sign In for Pricing
View Details
TRAPPC6B Protein Vector (Rat) (pPB-C-His)
PV312758 500 ng

TRAPPC6B Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Olfr821 Mouse qPCR Primer Pair (NM_146776)
MP210234 200 Reactions

Olfr821 Mouse qPCR Primer Pair (NM_146776)

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details