Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Probable sulfoacetaldehyde acetyltransferase (xsc), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rhizobium meliloti xsc protein, partial

Gene Name

Xsc

UniProt

Q92UW6

Expression Region

1-341aa

Organism

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Target Sequence

MKMTTEEAFVKVLQMHGIEHAFGIIGSAMMPVSDLFPKAGIRFWDCAHETNAGMMADGFSRATGTMSMAIGQNGPGVTGFITAMKTAYWNHTPLLMVTPQAANKTIGQGGFQEVDQMAMFEEMVCYQEEVRDPSRIPEVLNRVIEKAWRGCAPAQINIPRDFWTQVIDVDLPRIVRFERPAGGPAAIAQAARLLSEAKFPVILNGAGVVIGNAIQESMALAEKLDAPVCCGYQHNDAFPGSHRLSVGPLGYNGSKAAMELISKADVVLALGTRLNPFSTLPGYGIDYWPKDAAIIQVDINADRIGLTKKVTVGICGDAKQVAQQILQQLAPAAGDASREER

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.2 kDa

References & Citations

"The complete sequence of the 1,683-kb pSymB megaplasmid from the N2-fixing endosymbiont Sinorhizobium meliloti." Finan T.M., Weidner S., Wong K., Buhrmester J., Chain P., Vorhoelter F.J., Hernandez-Lucas I., Becker A., Cowie A., Gouzy J., Golding B., Puehler A. Proc. Natl. Acad. Sci. U.S.A. 98:9889-9894 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT5 3'UTR Luciferase Stable Cell Line
TU011950 1.0 mL

KRT5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phospho-CARM1 (Ser228) Polyclonal Antibody, Cy5.5 Conjugated
bs-5285R-Cy5.5 100 µL

Phospho-CARM1 (Ser228) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Tram1l1 (NM_001107724) Rat Tagged Lenti ORF Clone
RR210328L4 10 µg

Tram1l1 (NM_001107724) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bax polyclonal antibody
BS6420 50ul

Bax polyclonal antibody

Sign In for Pricing
View Details
Aipl1 Mouse qPCR Primer Pair (NM_053245)
MP200933 200 Reactions

Aipl1 Mouse qPCR Primer Pair (NM_053245)

Sign In for Pricing
View Details
VN1R95P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV789719 1.0 µg DNA

VN1R95P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details