Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP1, Human

RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RBP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rbp1-protein-human.html

Purity

98.0

Smiles

PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

Molecular Formula

5947 (Gene_ID) P09455 (P2-Q135) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV673777 1.0 µg DNA

PRMT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TSPAN18, ID (TSPAN18, Tetraspanin-18)
MBS6001994-01 0.2 mL

TSPAN18, ID (TSPAN18, Tetraspanin-18)

Sign In for Pricing
View Details
TSPAN18, ID (TSPAN18, Tetraspanin-18)
MBS6001994-02 5x 0.2 mL

TSPAN18, ID (TSPAN18, Tetraspanin-18)

Sign In for Pricing
View Details
Phospho-Akt2 (Ser474) Matched Antibody Pair
CST 42495S 1 Kit

Phospho-Akt2 (Ser474) Matched Antibody Pair

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to NEFH
MBS8596557-01 0.1 mL

Mouse Monoclonal Antibody to NEFH

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to NEFH
MBS8596557-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to NEFH

Sign In for Pricing
View Details