Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphopain A (sspP)

Product Specifications

Product Name Alternative

Staphopain A (EC 3.4.22.48) (Staphylococcal cysteine proteinase A) (Staphylopain A)

Abbreviation

Recombinant Staphylococcus aureus sspP protein

Gene Name

SspP

UniProt

P81297

Expression Region

215-388aa

Organism

Staphylococcus aureus

Target Sequence

YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Cysteine protease that plays an important role in the inhibition of host innate immune response. Cleaves host elastins found in connective tissues, pulmonary surfactant protein A in the lungs, and the chemokine receptor CXCR2 on leukocytes (PubMed:3422637, PubMed:23235402) . Proteolytic cleavage of surfactant protein A impairs bacterial phagocytocis by neutrophils while CXCR2 degradation blocks neutrophil activation and chemotaxis (PubMed:3422637, PubMed:23235402) . Additionally, promotes vascular leakage by activating the plasma kallikerin/kinin system, resulting in hypotension (PubMed:15897280) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.4 kDa

References & Citations

"Staphylococcus aureus proteases degrade lung surfactant protein A potentially impairing innate immunity of the lung." Kantyka T., Pyrc K., Gruca M., Smagur J., Plaza K., Guzik K., Zeglen S., Ochman M., Potempa J. J. Innate Immun. 5:251-260 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse IgM Antibody
DL22085F-01 25 μg

FITC Anti-Mouse IgM Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IgM Antibody
DL22085F-02 50 μg

FITC Anti-Mouse IgM Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse IgM Antibody
DL22085F-03 100 μg

FITC Anti-Mouse IgM Antibody

Sign In for Pricing
View Details
OASE00104-50UG - Erp57 (Grp58) Antibody
OASE00104-50UG 50 µg

OASE00104-50UG - Erp57 (Grp58) Antibody

Sign In for Pricing
View Details
BTA-EG4 hydrate
MBS5814577 Inquire

BTA-EG4 hydrate

Sign In for Pricing
View Details
ZO-3, Mid (Tight Junction-associated Polypeptide, Zonula Occludens 3) (HRP)
Z0774-HRP 100 µL

ZO-3, Mid (Tight Junction-associated Polypeptide, Zonula Occludens 3) (HRP)

Sign In for Pricing
View Details