Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIF1, Human (N-His)

The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AIF1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aif1-protein-human-n-his.html

Purity

97.60

Smiles

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Molecular Formula

199 (Gene_ID) P55008 (M1-P147) (Accession)

Molecular Weight

Approximately 19 KDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Cat IgG (H+L) antibody (FITC)
STJ99468-1mL 1 mL

Rabbit Anti-Cat IgG (H+L) antibody (FITC)

Sign In for Pricing
View Details
TSPAN5 Antibody, HRP conjugated
A37618-100UG 100 µg

TSPAN5 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse CD11a Antibody (RPE)
GWB-78BF12 100 Tests

Mouse CD11a Antibody (RPE)

Sign In for Pricing
View Details
(17β) -13-Ethyl-3-methoxygona-1,3,5 (10),15-tetraen-17-ol
sc-496935 1 mg

(17β) -13-Ethyl-3-methoxygona-1,3,5 (10),15-tetraen-17-ol

Sign In for Pricing
View Details
RGD735029 sgRNA CRISPR Lentivector set (Rat)
K7226901 3x 1.0 µg

RGD735029 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse HMGB1 (High mobility group protein B1) QuickTest ELISA Kit
MBS7620248-01 48 Well

Mouse HMGB1 (High mobility group protein B1) QuickTest ELISA Kit

Sign In for Pricing
View Details