Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spike Trimer (S1+S2), His-Tag (SARS-CoV-2) Recombinant

Recombinant SARS-CoV-2 Spike protein in its homotrimeric form, containing S1+S2 subunits and encompassing amino acids 16-1213. This protein corresponds to the wild-type (strain of reference) . The construct contains mutations 682RRAR685>A, K986P and V987P, and a T4 trimerization domain followed by a His-tag (6xHis) in C-terminal. The recombinant protein was affinity purified.

Product Specifications

UniProt

P0DTD1

Tag

C-terminal His-tag

Applications

Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

Purity

≥ 90%

Format

Aqueous buffer solution

Shipping Conditions

-80°C

Storage Conditions

At least 6 months at -80°C.

Calculated Molecular Weight

137 kDa + glycans

Formulation

8 mM phosphate, pH 7.4,110 mM NaCl, 2.2 mM KCl, and 20% glycerol.

Glycosylation

This protein runs at a higher MW by SDS-PAGE due to glycosylation.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nitrosofolic acid
orb1695893-01 25 mg

Nitrosofolic acid

Sign In for Pricing
View Details
Nitrosofolic acid
orb1695893-02 100 mg

Nitrosofolic acid

Sign In for Pricing
View Details
Nitrosofolic acid
orb1695893-03 50 mg

Nitrosofolic acid

Sign In for Pricing
View Details
RNU6-12 3'UTR Luciferase Stable Cell Line
TU020179 1.0 mL

RNU6-12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Great Saphenous Vein Smooth Muscle Cells
RPC-701 5x 10^5

Rabbit Great Saphenous Vein Smooth Muscle Cells

Sign In for Pricing
View Details
H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
PP49310-01 1 mg

H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH

Sign In for Pricing
View Details