Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human FARSB Protein

Product Specifications

CAS Number

9000-83-3

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM62 (Tripartite Motif-containing Protein 62)
MBS648622-01 0.1 mL

TRIM62 (Tripartite Motif-containing Protein 62)

Sign In for Pricing
View Details
TRIM62 (Tripartite Motif-containing Protein 62)
MBS648622-02 5x 0.1 mL

TRIM62 (Tripartite Motif-containing Protein 62)

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica YE3387 Protein (aa 1-330) (strain 8081)
VAng-Cr2493-1mgEcoli 1 mg (E. coli)

Recombinant Yersinia Enterocolitica YE3387 Protein (aa 1-330) (strain 8081)

Sign In for Pricing
View Details
FKBP38 (FKBP8) (NM_012181) Human Tagged ORF Clone Lentiviral Particle
RC216639L4V 200 µL

FKBP38 (FKBP8) (NM_012181) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
E2F-6 (E-5) Alexa Fluor® 790
sc-390022 AF790 200 µg/mL

E2F-6 (E-5) Alexa Fluor® 790

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details