Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 14, Human (HEK293, His)

Carbonic Anhydrase 14 Protein catalyzes the reversible hydration of carbon dioxide, converting it to bicarbonate ions and protons, and vice versa. Its vital enzymatic activity contributes to physiological processes, regulating acid-base balance, respiration, and cellular pH homeostasis. The protein plays a pivotal role in carbon dioxide transport and metabolism in the body. Carbonic Anhydrase 14 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-human-hek293-his.html

Purity

97.00

Smiles

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Molecular Formula

23632 (Gene_ID) Q9ULX7/NP_036245.1 (A16-M290) (Accession)

Molecular Weight

45-48 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-A Cyclase VIII antibody
STJ91400 200 µl

Anti-A Cyclase VIII antibody

Sign In for Pricing
View Details
OR5D18 siRNA (Human)
MBS8217737-01 15 nmol

OR5D18 siRNA (Human)

Sign In for Pricing
View Details
OR5D18 siRNA (Human)
MBS8217737-02 30 nmol

OR5D18 siRNA (Human)

Sign In for Pricing
View Details
OR5D18 siRNA (Human)
MBS8217737-03 5x 30 nmol

OR5D18 siRNA (Human)

Sign In for Pricing
View Details
Olr200 Protein Vector (Rat) (pPM-C-His)
PV289289 500 ng

Olr200 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
LCE3E ORF Vector (Human) (pORF)
ORF013559 1.0 µg DNA

LCE3E ORF Vector (Human) (pORF)

Sign In for Pricing
View Details