Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 14, Human (HEK293, His)

Carbonic Anhydrase 14 Protein catalyzes the reversible hydration of carbon dioxide, converting it to bicarbonate ions and protons, and vice versa. Its vital enzymatic activity contributes to physiological processes, regulating acid-base balance, respiration, and cellular pH homeostasis. The protein plays a pivotal role in carbon dioxide transport and metabolism in the body. Carbonic Anhydrase 14 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-human-hek293-his.html

Purity

97.00

Smiles

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Molecular Formula

23632 (Gene_ID) Q9ULX7/NP_036245.1 (A16-M290) (Accession)

Molecular Weight

45-48 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Aldo-keto reductase family 1member C4, AKR1C4 ELISA Kit
SL3032Hu-01 96 Tests

Human Aldo-keto reductase family 1member C4, AKR1C4 ELISA Kit

Sign In for Pricing
View Details
Human Aldo-keto reductase family 1member C4, AKR1C4 ELISA Kit
SL3032Hu-02 48 Tests

Human Aldo-keto reductase family 1member C4, AKR1C4 ELISA Kit

Sign In for Pricing
View Details
BCA Protein Quantification Kit (Ready to use)
20200ES76 500 Tests

BCA Protein Quantification Kit (Ready to use)

Sign In for Pricing
View Details
8-Bromoquinoline
440057-01 100 mg

8-Bromoquinoline

Sign In for Pricing
View Details
8-Bromoquinoline
440057-02 250 mg

8-Bromoquinoline

Sign In for Pricing
View Details
DGKQ Rabbit Polyclonal Antibody
MBS9465856-01 0.05 mL

DGKQ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details