Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 14, Human (HEK293, His)

Carbonic Anhydrase 14 Protein catalyzes the reversible hydration of carbon dioxide, converting it to bicarbonate ions and protons, and vice versa. Its vital enzymatic activity contributes to physiological processes, regulating acid-base balance, respiration, and cellular pH homeostasis. The protein plays a pivotal role in carbon dioxide transport and metabolism in the body. Carbonic Anhydrase 14 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-human-hek293-his.html

Purity

97.00

Smiles

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Molecular Formula

23632 (Gene_ID) Q9ULX7/NP_036245.1 (A16-M290) (Accession)

Molecular Weight

45-48 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Canine Anionic Trypsin Polyclonal Antibody-[Biotin]
VD11N603 1 Each

Rabbit Anti-Canine Anionic Trypsin Polyclonal Antibody-[Biotin]

Sign In for Pricing
View Details
VSIG1, CT (VSIG1, GPA34, V-set and immunoglobulin domain-containing protein 1, Cell surface A33 antigen, Glycoprotein A34) (MaxLight 750) discontinued
043782-ML750 100 µL

VSIG1, CT (VSIG1, GPA34, V-set and immunoglobulin domain-containing protein 1, Cell surface A33 antigen, Glycoprotein A34) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LANCL1 (NM_001136575) Human Tagged Lenti ORF Clone
RC226718L3 10 µg

LANCL1 (NM_001136575) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Interleukin 23 ELISA Kit
MBS733178-01 48 Strip Well

Rabbit Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 23 ELISA Kit
MBS733178-02 96 Strip Well

Rabbit Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Rabbit Interleukin 23 ELISA Kit
MBS733178-03 5x 96 Strip Well

Rabbit Interleukin 23 ELISA Kit

Sign In for Pricing
View Details