Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 14, Human (HEK293, His)

Carbonic Anhydrase 14 Protein catalyzes the reversible hydration of carbon dioxide, converting it to bicarbonate ions and protons, and vice versa. Its vital enzymatic activity contributes to physiological processes, regulating acid-base balance, respiration, and cellular pH homeostasis. The protein plays a pivotal role in carbon dioxide transport and metabolism in the body. Carbonic Anhydrase 14 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-human-hek293-his.html

Purity

97.00

Smiles

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM

Molecular Formula

23632 (Gene_ID) Q9ULX7/NP_036245.1 (A16-M290) (Accession)

Molecular Weight

45-48 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI2D4]
TA500631 100 µL

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI2D4]

Sign In for Pricing
View Details
SDF-1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0003307 1.0 µg DNA

SDF-1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MTMR6 sgRNA CRISPR Lentivector set (Human)
K1362801 3x 1.0 µg

MTMR6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human ARHGAP11B qPCR Primer Pair
QH57441S 200 Tests

Human ARHGAP11B qPCR Primer Pair

Sign In for Pricing
View Details
AHR antibody
MBS535639-01 0.05 mg

AHR antibody

Sign In for Pricing
View Details
AHR antibody
MBS535639-02 5x 0.05 mg

AHR antibody

Sign In for Pricing
View Details