15-PGDH/HPGD, Human (HEK293, His)
15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].
Product Specifications
Product Name Alternative
15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html
Purity
99.90
Smiles
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Molecular Formula
3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
168795-AF-ML750 100 µL
HLA-DR (DR alpha chain, DRB1, DRB4, HLA class II histocompatibility antigen, HLA class II histocompatibility antigen DR alpha chain, HLA DR1B, HLA DR3B, HLA DRA, HLA DRA1, HLA DRB1, HLA DRB3, HLA DRB4, HLA DRB5, HLA-DRA, HLADR4B, HLADRA1, HLADRB, Major histocompatibility complex class II DR alpha, Major histocompatibility complex class II DR beta 1, Major histocompatibility complex class II DR beta 3, Major histocompatibility complex class II DR beta 4, Major histocompatibility complex class II DR beta 5, MHC cell surface glycoprotein, MHC class II antigen DRA) (BSA & Azide Free) (MaxLight 750) discontinued
Sign In for Pricing
View Details