Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (HEK293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html

Purity

99.90

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpa1 (NM_025350) Mouse Tagged ORF Clone
MG206658 10 µg

Cpa1 (NM_025350) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse NAA40 Protein, His (Fc)-Avi-tagged
NAA40-5884M 50 µg

Recombinant Mouse NAA40 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Human SIPA1L3 knockout cell line
ABC-KH13811 1 Vial

Human SIPA1L3 knockout cell line

Sign In for Pricing
View Details
Antimicrobial agent-36
HY-170609 1 Each

Antimicrobial agent-36

Sign In for Pricing
View Details
Mouse Rpl15 (BC091735) AAV Particle
MR202133A1V 250 µL

Mouse Rpl15 (BC091735) AAV Particle

Sign In for Pricing
View Details
Nek9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4707205 3x 1.0 µg

Nek9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details