Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (HEK293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html

Purity

99.90

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 19 Antibody (A53-B/A2.26) [Janelia Fluor 646]
NBP2-33134JF646 0.1 mL

Mouse Monoclonal Cytokeratin 19 Antibody (A53-B/A2.26) [Janelia Fluor 646]

Sign In for Pricing
View Details
Rat Dner Pre-designed siRNA Set B
SI203956B 1 Each

Rat Dner Pre-designed siRNA Set B

Sign In for Pricing
View Details
FAM53B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV642728 1.0 µg DNA

FAM53B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse TCR Vγ 3 Antibody , PerCP
E55A09887 50 Tests

Mouse TCR Vγ 3 Antibody , PerCP

Sign In for Pricing
View Details
POLR2D Protein Vector (Mouse) (pPM-C-HA)
PV217820 500 ng

POLR2D Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Equine Erythropoietin (EPO) Polyclonal Antibody
KP1144E-01 20 µg

Equine Erythropoietin (EPO) Polyclonal Antibody

Sign In for Pricing
View Details