Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (HEK293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html

Purity

99.90

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0135906 1.0 µg DNA

ASPH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human FBXO43 Protein Lysate
MBS8411649-01 0.02 mg

Human FBXO43 Protein Lysate

Sign In for Pricing
View Details
Human FBXO43 Protein Lysate
MBS8411649-02 5x 0.02 mg

Human FBXO43 Protein Lysate

Sign In for Pricing
View Details
Zbtb1 (NM_178744) Mouse Tagged Lenti ORF Clone
MR220391L4 10 µg

Zbtb1 (NM_178744) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal MGMT Antibody (MGMT/8364R) - Azide and BSA Free
NBP3-21104 100 µg

Rabbit Monoclonal MGMT Antibody (MGMT/8364R) - Azide and BSA Free

Sign In for Pricing
View Details
Rab2a Mouse qPCR Primer Pair (NM_021518)
MP212314 200 Reactions

Rab2a Mouse qPCR Primer Pair (NM_021518)

Sign In for Pricing
View Details