Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (HEK293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html

Purity

99.90

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Heat Shock Factor-Binding Protein 1 (HSBP1) ELISA Kit
abx391437 96 Tests

Rat Heat Shock Factor-Binding Protein 1 (HSBP1) ELISA Kit

Sign In for Pricing
View Details
Fbxo18 Mouse qPCR Template Standard (NM_015792)
MK201706 1 Kit

Fbxo18 Mouse qPCR Template Standard (NM_015792)

Sign In for Pricing
View Details
3-Chloro-2-ethylbenzoic acid
424827-01 25 mg

3-Chloro-2-ethylbenzoic acid

Sign In for Pricing
View Details
3-Chloro-2-ethylbenzoic acid
424827-02 50 mg

3-Chloro-2-ethylbenzoic acid

Sign In for Pricing
View Details
Chongqing Precision Biosimilar (Monoclonal, IgG1)
A138796 100 µL

Chongqing Precision Biosimilar (Monoclonal, IgG1)

Sign In for Pricing
View Details
SMAD6 Protein, Human, Recombinant (E. coli, His & Myc)
MF-0103839-01 5 µg

SMAD6 Protein, Human, Recombinant (E. coli, His & Myc)

Sign In for Pricing
View Details