Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (HEK293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html

Purity

99.90

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grsf1 (NM_178700) Mouse Tagged ORF Clone Lentiviral Particle
MR216357L4V 200 µL

Grsf1 (NM_178700) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Krt6a shRNA (UAS) - Lentiviral mouse Krt6a shRNA (UAS) (100)
GTR15222654 1 Vial

Lentiviral mouse Krt6a shRNA (UAS) - Lentiviral mouse Krt6a shRNA (UAS) (100)

Sign In for Pricing
View Details
TAGLN2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46105061 1.0 µg DNA

TAGLN2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Compound STOCK1N-67473
MBS5792267 Inquire

Compound STOCK1N-67473

Sign In for Pricing
View Details
ACADL Recombinant Protein (Human)
RP000205 100 µg

ACADL Recombinant Protein (Human)

Sign In for Pricing
View Details
LRRC57 Human shRNA Plasmid Kit (Locus ID 255252)
TL303443 1 Kit

LRRC57 Human shRNA Plasmid Kit (Locus ID 255252)

Sign In for Pricing
View Details