Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (HEK293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html

Purity

99.90

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOXL2 (Lysyl Oxidase-like 2, LOR2, WS9-14) (Biotin)
MBS6172731-01 0.1 mL

LOXL2 (Lysyl Oxidase-like 2, LOR2, WS9-14) (Biotin)

Sign In for Pricing
View Details
LOXL2 (Lysyl Oxidase-like 2, LOR2, WS9-14) (Biotin)
MBS6172731-02 5x 0.1 mL

LOXL2 (Lysyl Oxidase-like 2, LOR2, WS9-14) (Biotin)

Sign In for Pricing
View Details
HGV Real-TM Qual Real Time PCR Test for detection of HGV
V2-50FRT 50 Tests

HGV Real-TM Qual Real Time PCR Test for detection of HGV

Sign In for Pricing
View Details
Mouse C-X-C chemokine receptor type 1 ELISA Kit
MBS289900-01 48 Well

Mouse C-X-C chemokine receptor type 1 ELISA Kit

Sign In for Pricing
View Details
Mouse C-X-C chemokine receptor type 1 ELISA Kit
MBS289900-02 96 Well

Mouse C-X-C chemokine receptor type 1 ELISA Kit

Sign In for Pricing
View Details
Mouse C-X-C chemokine receptor type 1 ELISA Kit
MBS289900-03 5x 96 Well

Mouse C-X-C chemokine receptor type 1 ELISA Kit

Sign In for Pricing
View Details