Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

15-PGDH/HPGD, Human (HEK293, His)

15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].

Product Specifications

Product Name Alternative

15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html

Purity

99.90

Smiles

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Molecular Formula

3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk anti-Human HLA-DP antibody (B7/21) - Ultra-Low Endotoxin
ICH1024UL-5mg 5 mg

Bulk anti-Human HLA-DP antibody (B7/21) - Ultra-Low Endotoxin

Sign In for Pricing
View Details
C17orf85 Double Nickase Plasmid (h)
sc-412533-NIC 20 µg

C17orf85 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
MAP3K15 (NM_001001671) Human Mass Spec Standard
PH323307 10 µg

MAP3K15 (NM_001001671) Human Mass Spec Standard

Sign In for Pricing
View Details
Indatuximab Biosimilar (Monoclonal, IgG4)
A138670 100 µL

Indatuximab Biosimilar (Monoclonal, IgG4)

Sign In for Pricing
View Details
ANKRD43 sgRNA CRISPR Lentivector (Human) (Target 3)
K0092704 1.0 µg DNA

ANKRD43 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable coatomer subunit zeta (ret3)
MBS1058975-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Probable coatomer subunit zeta (ret3)

Sign In for Pricing
View Details