15-PGDH/HPGD, Human (HEK293, His)
15-PGDH/HPGD Protein, Human (HEK 293, His) is a recombinant human 15-PGDH/HPGD Protein expressed in HEK293 with a His tag at the N-terminus. 15-PGDH/HPGD, a key enzyme in the degradation of prostaglandins, plays an important role in the development of inflammation-related diseases[1].
Product Specifications
Product Name Alternative
15-PGDH/HPGD Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/15-pgdh-hpgd-protein-human-hek-293-his.html
Purity
99.90
Smiles
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Molecular Formula
3248 (Gene_ID) P15428-1 (M1-Q266) (Accession)
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Shuying Miao, et al.Pharmacologic Blockade of 15-PGDH Protects Against Acute Renal Injury Induced by LPS in Mice. Front Physiol. 2020 Mar 13;11:138.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6310456-01 0.2 mL
IN80B, ID (INO80B, HMGA1L4, PAPA1, ZNHIT4, INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, PAP-1-associated protein 1, Zinc finger HIT domain-containing protein 4) (Biotin)
Sign In for Pricing
View Details MBS6310456-02 5x 0.2 mL
IN80B, ID (INO80B, HMGA1L4, PAPA1, ZNHIT4, INO80 complex subunit B, High mobility group AT-hook 1-like 4, IES2 homolog, PAP-1-associated protein 1, Zinc finger HIT domain-containing protein 4) (Biotin)
Sign In for Pricing
View Details