Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free TNF-beta/TNFSF1, Human (His)

TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. Animal-Free TNF-beta/TNFSF1 Protein, Human (His) is the recombinant human-derived animal-FreeTNF-beta/TNFSF1 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free TNF-beta/TNFSF1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-tnf-beta-tnfsf1-protein-human-his.html

Purity

95.0

Smiles

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Molecular Formula

4049 (Gene_ID) P01374 (L35-L205) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFNG (Beta-1,3-N-acetylglucosaminyltransferase Radical Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) (MaxLight 405) discontinued
132498-ML405 100 µL

RFNG (Beta-1,3-N-acetylglucosaminyltransferase Radical Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Slc15a1 siRNA Oligos set (Mouse)
43886174 3x 5 nmol

Slc15a1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TG4-155 5mg
A20758-5 5 mg

TG4-155 5mg

Sign In for Pricing
View Details
Camel Apelin 17 ELISA Kit
MBS078816-01 48 Well

Camel Apelin 17 ELISA Kit

Sign In for Pricing
View Details
Camel Apelin 17 ELISA Kit
MBS078816-02 96 Well

Camel Apelin 17 ELISA Kit

Sign In for Pricing
View Details
Camel Apelin 17 ELISA Kit
MBS078816-03 5x 96 Well

Camel Apelin 17 ELISA Kit

Sign In for Pricing
View Details