Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5, Human (His)

The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (GST) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

EIF5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eif5-protein-human-gst.html

Purity

98.0

Smiles

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD

Molecular Formula

1983 (Gene_ID) P55010 (M1-D150) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tigd5 (NM_178646) Mouse Tagged ORF Clone Lentiviral Particle
MR214775L3V 200 µL

Tigd5 (NM_178646) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PCDHA1 (Protocadherin alpha-1, PCDH-alpha-1) (MaxLight 750) discontinued
130947-ML750 100 µL

PCDHA1 (Protocadherin alpha-1, PCDH-alpha-1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ArcticExpress (DE3) pRARE2 Super Competent Cells
D1003S 10x 100 μL

ArcticExpress (DE3) pRARE2 Super Competent Cells

Sign In for Pricing
View Details
Bovine Uroplakin 1B (UPK1B) ELISA Kit
MBS9939973-01 48 Well

Bovine Uroplakin 1B (UPK1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Uroplakin 1B (UPK1B) ELISA Kit
MBS9939973-02 96 Well

Bovine Uroplakin 1B (UPK1B) ELISA Kit

Sign In for Pricing
View Details
Bovine Uroplakin 1B (UPK1B) ELISA Kit
MBS9939973-03 5x 96 Well

Bovine Uroplakin 1B (UPK1B) ELISA Kit

Sign In for Pricing
View Details