EIF5, Human (His)
The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (GST) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
EIF5 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/eif5-protein-human-gst.html
Purity
98.0
Smiles
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD
Molecular Formula
1983 (Gene_ID) P55010 (M1-D150) (Accession)
Molecular Weight
Approximately 18 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Recombinant Arabidopsis thaliana Thylakoid lumenal 15 kDa protein 1, chloroplastic (At2g44920)
Recombinant Arabidopsis thaliana Thylakoid lumenal 15 kDa protein 1, chloroplastic (At2g44920)
Recombinant Arabidopsis thaliana Thylakoid lumenal 15 kDa protein 1, chloroplastic (At2g44920)
Recombinant Arabidopsis thaliana Thylakoid lumenal 15 kDa protein 1, chloroplastic (At2g44920)
Recombinant Arabidopsis thaliana Thylakoid lumenal 15 kDa protein 1, chloroplastic (At2g44920)
