Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibronectin, Human (Biotinylated, His-Avi)

Fibronectin binds collagen, fibrin, heparin, DNA, and actin. It is involved in cell adhesion, motility, opsonization, wound healing and maintenance of cell shape. Fibronectin Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived Fibronectin protein, expressed by E. coli , with N-Avi, N-6*His labeled tag.

Product Specifications

Product Name Alternative

Fibronectin Protein, Human (Biotinylated, His-Avi), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fibronectin-protein-human-his-avi.html

Purity

97.00

Smiles

EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFT

Molecular Formula

2335 (Gene_ID) P02751-15 (E1266-T1356) (Accession)

Molecular Weight

Approximately 13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1 Alpha (Hypoxia-Inducible Factor 1 alpha) (MaxLight 750) discontinued
214886-ML750 100 µL

HIF1 Alpha (Hypoxia-Inducible Factor 1 alpha) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Anti Human EIF4EBP1 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)
IRBAHUEIF4EBP1AP327200UL 1 Each

Rabbit Anti Human EIF4EBP1 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)

Sign In for Pricing
View Details
CDX4 Polyclonal Antibody, Cy5 Conjugated
bs-12301R-Cy5 100 µL

CDX4 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
HEXIM2 Antibody
OAGA06767-100UL 100 µL

HEXIM2 Antibody

Sign In for Pricing
View Details
DNA Mouse Monoclonal Antibody
orb2960786-01 50 µg

DNA Mouse Monoclonal Antibody

Sign In for Pricing
View Details
DNA Mouse Monoclonal Antibody
orb2960786-02 100 µg

DNA Mouse Monoclonal Antibody

Sign In for Pricing
View Details