Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (CHO)

G-CSF Protein, Human (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-cho.html

Purity

96

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) Q8N4W3 (T27-P200) /P09919-2 (T31-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALP (PDLIM3) (NM_014476) Human Over-expression Lysate
LY402338 100 µg

ALP (PDLIM3) (NM_014476) Human Over-expression Lysate

Sign In for Pricing
View Details
INPP1 (NM_002194) Human Recombinant Protein
TP310604L 1 mg

INPP1 (NM_002194) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS629084 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
IGFL3 (NM_207393) Human Over-expression Lysate
LY404004 100 µg

IGFL3 (NM_207393) Human Over-expression Lysate

Sign In for Pricing
View Details
FGF18 (N-term) Rabbit Polyclonal Antibody
AP17367PU-N 400 µL

FGF18 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BACH1 Antibody
KC-3522-01 50 μL

BACH1 Antibody

Sign In for Pricing
View Details