Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (CHO)

G-CSF Protein, Human (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-cho.html

Purity

96

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) Q8N4W3 (T27-P200) /P09919-2 (T31-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD57 (B3GAT1) activation kit by CRISPRa
GA108999 1 Kit

Human CD57 (B3GAT1) activation kit by CRISPRa

Sign In for Pricing
View Details
APC Anti-Human CD19 Antibody[SJ25C1]
AN00334E-01 20 Tests

APC Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
APC Anti-Human CD19 Antibody[SJ25C1]
AN00334E-02 100 Tests

APC Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
APC Anti-Human CD19 Antibody[SJ25C1]
AN00334E-03 2x 100 Tests

APC Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
Diphenyl p-Hydroxyphenyl Phosphate
TRC-D492418-500MG 500 mg

Diphenyl p-Hydroxyphenyl Phosphate

Sign In for Pricing
View Details
NIPP1 (PPP1R8) Human qPCR Primer Pair (NM_014110)
HP225722 200 Reactions

NIPP1 (PPP1R8) Human qPCR Primer Pair (NM_014110)

Sign In for Pricing
View Details