G-CSF, Human (CHO)
G-CSF Protein, Human (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.
Product Specifications
Product Name Alternative
G-CSF Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/g-csf-protein-human-cho.html
Purity
96
Smiles
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Molecular Formula
1440 (Gene_ID) Q8N4W3 (T27-P200) /P09919-2 (T31-P204) (Accession)
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401970-100 1x 100 µL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681594-100 1x 100 µL
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details